Method of culturing pluripotent stem cell, and polypeptide to be used therefor
US10407662B2 · kind B2 · utility
Assignee
Inventors
Key dates
| Filing date | Oct 12, 2016 |
| Grant date | Sep 10, 2019 |
| Priority date | — |
| Expiry date | Mar 15, 2037 |
Classification
- Technology area (CPC C)Chemistry; Metallurgy
- CPC primaryC12N2537/00
- WIPO fieldBiotechnology
- WIPO sectorChemistry
Abstract
A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.