Patent · US Active

Method of culturing pluripotent stem cell, and polypeptide to be used therefor

US10407662B2 · kind B2 · utility

0Cited by
2References
4Claims
0Family size

Assignee

Inventors

Key dates

Filing dateOct 12, 2016
Grant dateSep 10, 2019
Priority date
Expiry dateMar 15, 2037

Classification

  • Technology area (CPC C)Chemistry; Metallurgy
  • CPC primaryC12N2537/00
  • WIPO fieldBiotechnology
  • WIPO sectorChemistry

Abstract

A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.