Patent · US Active

Culture method for pluripotent stem cells

US10487307B2 · kind B2 · utility

0Cited by
0References
11Claims
0Family size

Assignee

Inventors

Key dates

Filing dateMar 9, 2016
Grant dateNov 26, 2019
Priority date
Expiry dateAug 25, 2036

Classification

  • Technology area (CPC C)Chemistry; Metallurgy
  • CPC primaryC12N2533/50
  • WIPO fieldBiotechnology
  • WIPO sectorChemistry

Abstract

A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 μM in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids in the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.