Patent · US Expired

78 residue polypeptide (NK-lysine) and its use

US5981469A · kind A · utility

1Cited by

0References

15Claims

0Family size

Inventors

Mats Andersson · Mullsjö, SE
Hans Boman · Stockholm, SE
Hans Jornvall · Mölndal, SE
Viktor Mutt · Solna, SE

Key dates

Filing date	Dec 4, 1996
Grant date	Nov 9, 1999
Priority date	—
Expiry date	Dec 4, 2016

Classification

Technology area (CPC A)Human Necessities
CPC primaryA61K38/00
WIPO fieldPharmaceuticals
WIPO sectorChemistry

Abstract

A 78 residue polypeptide comprising the following amino acid sequence EQU GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKK PQAICVDIKICKE [SEQ ID NO:1]: and functional derivatives and pharmaceutically acceptable salts thereof, said sequence comprising intra-linked half-cysteines; pharmaceutical composition containing such polypeptide as an active ingredient; a method for inhibiting microbial growth and cancer cell growth in animals including man; and nucleotide sequence corresponding to such polypeptide.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.