Patent · US Expired

Fragments of CR1 and their use

US6797806B2 · kind B2 · utility

0Cited by

1References

18Claims

0Family size

Assignee

Adprotech Limited · GB

Inventors

Danuta Ewa Irena Mossakowska · Bishop's Stortford, GB
Colin Michael Edge · Harlow, GB
Richard Smith · Cambridge, GB

Key dates

Filing date	Dec 1, 1998
Grant date	Sep 28, 2004
Priority date	—
Expiry date	Dec 1, 2018

Classification

Technology area (CPC A)Human Necessities
CPC primaryA61K38/00
WIPO fieldPharmaceuticals
WIPO sectorChemistry

Abstract

A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compositions containing them and their use in therapy.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.