Patent · US Expired

Modified hirudin proteins and T-cell epitopes in hirudin

US7425533B2 · kind B2 · utility

1Cited by
2References
2Claims
0Family size

Assignee

Inventors

Key dates

Filing dateJun 25, 2004
Grant dateSep 16, 2008
Priority date
Expiry dateAug 3, 2024

Classification

  • Technology area (CPC C)Chemistry; Metallurgy
  • CPC primaryC07K14/815
  • WIPO fieldBiotechnology
  • WIPO sectorChemistry

Abstract

Modified forms of hirudin having improved properties are disclosed. The modified hirudin compounds are hirudin variants comprising amino acid substitutions in the sequence of hirudin. Peptide molecules consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE (SEQ ID NO: 1) or a sequence consisting of at least 9 consecutive amino acid residues of SEQ ID NO: 1 having a potential MHC class II binding activity are disclosed. The peptide has a stimulation index of >1.8 in a biological assay of cellular proliferation, in which the index is defined as the value of cellular proliferation scored following stimulation by the peptide and divided by the value of cellular proliferation scored in control cells that have not been exposed to the peptide.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.