IL-17A binding molecules and medical uses thereof

US9315557B2 · kind B2 · utility

Assignee

• Covagen AG · CH

Inventors

• Michela Sillacci Melkko · Schlieren, CH
• Nadja Banziger · Schlieren, CH
• Richard Woods · Schlieren, CH
• Wenjuan Zha · Singapore, SG
• Isabella Attinger · Schlieren, CH
• Roger Santimaria · Schlieren, CH
• Wibke Lembke · Schlieren, CH
• Sarah Batey · Cambridge, GB
• Ulrike Von Der Bey · Aach, DE
• Julian Bertschinger · Ottenbach, CH
• Dragan Grabulovski · Zürich, CH

Key dates

• Filing date: Sep 19, 2013
• Grant date: Apr 19, 2016
• Expiry date: Sep 19, 2033

Classification

• Technology area (CPC C): Chemistry; Metallurgy
• CPC primary: C07K2319/30
• WIPO field: Pharmaceuticals
• WIPO sector: Chemistry

Abstract

The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.