IL-17A binding molecules and medical uses thereof
US9315557B2 · kind B2 · utility
Assignee
Inventors
Key dates
| Filing date | Sep 19, 2013 |
| Grant date | Apr 19, 2016 |
| Priority date | — |
| Expiry date | Sep 19, 2033 |
Classification
- Technology area (CPC C)Chemistry; Metallurgy
- CPC primaryC07K2319/30
- WIPO fieldPharmaceuticals
- WIPO sectorChemistry
Abstract
The present invention relates to a polypeptide inhibiting the activity of glycosylated IL-17A, wherein the polypeptide comprises or consists of an amino acid sequence selected from the group consisting of: (a) GVTLFVALYDY(X1)(X2)(X3)(X4)(X5)(X6) DLSFHKGEKFQIL STHEYEDWWEARSLTTGETGYIPSNYVAPVDSIQ (SEQ ID NO: 1), wherein amino acid positions (X1) to (X6) may be any amino acid sequence; and (b) an amino acid sequence which is at least 85% identical to the amino acid sequence of (a), wherein the identity determination excludes amino acid positions (X1) to (X6) and provided that the amino acid sequence STHEYE (SEQ ID NO: 2) in amino acid positions 31 to 36 of SEQ ID NO: 1 is conserved. The invention also relates to fusion constructs, compositions and medical uses comprising said polypeptide.
Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.