Patent · US Active

Treatment of cancer

US9376492B2 · kind B2 · utility

1Cited by
2References
5Claims
0Family size

Assignee

Inventor

Key dates

Filing dateSep 22, 2010
Grant dateJun 28, 2016
Priority date
Expiry dateJan 11, 2031

Classification

  • Technology area (CPC C)Chemistry; Metallurgy
  • CPC primaryC07K2317/76
  • WIPO fieldPharmaceuticals
  • WIPO sectorChemistry

Abstract

The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.

Source: USPTO / EPO open patent data. Objective bibliographic and citation counts.