Multideterminant peptides eliciting helper T-lymphocyte, cytotoxic T-lymphocyte, and neutralizing antibody responses against HIV-1

US5932218A · kind A · utility

Assignee

• The United States of America, as represented by the Department of Health and Human Services · US

Inventors

• Jay A. Berzofsky · Bethesda, US
• Jeffrey D. Ahlers · Winterville, US
• C. David Pendelton · Bethesda, US
• Peter L. Nara · Frederick, US
• Mutsunori Shirai · Rockville, US

Key dates

• Filing date: May 31, 1995
• Grant date: Aug 3, 1999
• Expiry date: May 31, 2015

Classification

• Technology area (CPC Y): Emerging Cross-Sectional Technologies
• CPC primary: Y02A50/30
• WIPO field: Pharmaceuticals
• WIPO sector: Chemistry

Abstract

This invention is directed toward a multideterminant human immunodeficiency virus type 1 (HIV-1) peptide which comprises a covalently linked T-helper (Th) lymphocyte epitope, cytotoxic T-lymphocyte (CTL) epitope, and an epitope capable of eliciting a neutralizing antibody response (AbN), wherein said peptide has the following amino acid sequence: KQIINMWQEVGKAMYAPPISGQIRRIHIGPGRAFYTTKN. This peptide has the further characteristic of evoking all three of these immune responses in hosts having a broad range of major histocompatibility complex (MHC) types. This peptide is useful as an immunogen to generate broad immune responses in a host, to assess immune responses in virally infected hosts, and as a diagnostic reagent to detect viral infection.